Together with AlgJ and AlgF, forms an inner membrane complex which probably interacts with the alginate polymerization-transport complex and adds acetyl groups at the O-2 and O-3 positions of mannuronate residues. Acetylation of alginate is important for the architecture of biofilms and increases the ability of alginate to act as a defense barrier (By similarity).

Belongs to the membrane-bound acyltransferase family.

495 amino acids

MVFSSNVFLFLFLPIFLGLYYLSGQRYRNLLLLLASYVFYAWWRVDFLALFAAVTLWNYWIGLKVGAAGVRTKPAQRWLLLGVVVDSINVMMKSAGLEPFILTHVLLPIGISFYIFESISYIIDVYRGDTPATRNLIDFAAFVAIFPHLIAGPVLRFRDLADQFNNRTHTLDKFSEGCTRFMQGFIKKVFIADTLAVVADHCFALQNPTTGDAWLGALAYTAQLYFDFSGYSDMAIGLGLMMGFRFMENFKQPYISQSITEFWRRWHISLSTWLRDYLYITLGGNRKGTLTTYRNLFLTMLLGGLWHGANITYIVWGAWHGMWLAIEKAIGLNTSPRSFNPVRWAFTFLLVVMGWVIFRAENLHVAGRMYGAMFSFGEWSLSELNRANLTGLQVATLVVAYATLAFFGLRDFYTNRPAEKTKPADPSLIKAVPGDNPGSIHEPGFTVGQDAAVQPAYWTADWPRYAMRAAVLLLFVASILKLSAQSFSPFLYFQF

56.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algI using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here