Does not function as a glutathione-disulfide oxidoreductase in the presence of glutathione and glutathione reductase. May be a component of a ribonucleotide-reducing system distinct from the previously described systems utilizing thioredoxin or glutaredoxin.

Belongs to the glutaredoxin family.

85 amino acids

MVVKIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIDYGLMAVPAIAINGVVRFVGAPGREELFEAISDEIE

9.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MTBMA_c12030 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here