Catalyzes the reversible phosphorylation of S-methyl-5'-thioinosine (MTI) to hypoxanthine and 5-methylthioribose-1-phosphate. Involved in the breakdown of S-methyl-5'-thioadenosine (MTA), a major by-product of polyamine biosynthesis. Catabolism of (MTA) occurs via deamination to MTI and phosphorolysis to hypoxanthine.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

258 amino acids

MDEEAEVAEIAVLGGVGFNSHKDCESHPVTTPYGRITAYLTSIKGRSVVIIPRHAEEIHIPPHRVNYRGNIWAAHSLGAKRVISTNSVGSMRGHPVGSFVVLDDFIDFTRSRPSTFHDDKTVHVDVSEPYCPEIRASLRYSLEKRGISYTEGVYACTEGPRFETRAEIRMMSQFADVVGMTGVPEVVLAKELSLCYASLSIVTNQACGMTTQKLTADEVTEVVGKAQASIFKILSDAIGKIPETRNCMCRFAKEGACL

28.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MA_1409 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here