Removes the 2'-phosphate from RNA via an intermediate in which the phosphate is ADP-ribosylated by NAD followed by a presumed transesterification to release the RNA and generate ADP-ribose 1''-2''-cyclic phosphate (APPR>P). May function as an ADP-ribosylase (By similarity).

Belongs to the KptA/TPT1 family.

216 amino acids

MDLGICKRCGEFEGSCECGKGEVLLKSEDRKKVSKFLSGLLRHFGRDFGVRLDEDGWAELRDVLKILSERYGVGRKHVELIVKFDPKGRFELKNGRIRAKYGHSVEVRTDWSEGGEIPEKLYHATSPENLNSILKTGLLPMRRREVHMCSSPQEAIEVGKRHSSNPVLLEIDAKGLMQDGIEVRRKGKVYTVDFVPPKFIRVLSFDPRSPNPAKGY

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make kptA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here