Catalyzes the initial reaction in the xylose utilization pathway by reducing D-xylose into xylitol. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway (By similarity).

Belongs to the aldo/keto reductase family.

319 amino acids

MASPTVKLNSGHDMPLVGFGLWKVNNETCADQVYEAIKAGYRLFDGACDYGNEVECGQGVARAIKEGIVKREELFIVSKLWNSFHEGDRVEPICRKQLADWGVDYFDLYIVHFPVALKYVDPAVRYPPGWNSESGKIEFSNATIQETWTAMESLVDKKLARSIGVSNFSAQLLMDLLRYARVRPATLQIEHHPYLTQPRLVEYAQKEGIAVTAYSSFGPLSFLELEVKNAVDTPPLFEHNTIKSLAEKYGKTPAQVLLRWATQRGIAVIPKSNNPTRLSQNLEVTGWDLEKSELEAISSLDKGLRFNDPIGYGMYVPIF

35.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xyl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here