Necessary for normal cell division and for the maintenance of normal septation.

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. EngB GTPase family.

198 amino acids

MRIKKSDFITSAVKKNQYPIDNRVEVAFVGRSNVGKSSLINSLTNRKKLAKVSQTPGKTRLVNFFLINDDFYLVDLPGYGYAKVSKAEKDSWGKTVEMYLTGREQLKRVVLLVDSRHKPTGDDIIMHEWIKHFGYDVIVVATKSDKLTRNELKKNEKVIKETLKLNSDDKLYFFSSLNKDGKDELIDNLFLEFATDLD

22.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make engB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here