May function as a transcriptional regulator that controls feoABC expression.

Belongs to the FeoC family.

78 amino acids

MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLKQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLHEWWALR

8.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make feoC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here