Could be a mediator in iron transactions between iron acquisition and iron-requiring processes, such as synthesis and/or repair of Fe-S clusters in biosynthetic enzymes.

Belongs to the Fe(2+)-trafficking protein family.

90 amino acids

MSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQTMLINERRLNMMNAEDRKFLQQEMDKFLSGEDYAKADGYVPPSA

10.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PA5148 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here