Is able to catalyze the degradation of n-alkanes with C chain lengths of 32 and 36. Probably allows Acinetobacter baylyi strain ADP1 to grow on the long-chain n-alkane dotriacontane (C32H66) as a sole carbon source.

Belongs to the FAD-binding monooxygenase family.

498 amino acids

MEKHIDILIVGAGISGIGIAAHLSKDAPQRQFEIIERRENIGGTWDLFRYPGIRSDSDMSTFGFNFKPWQSPNVLASGSSIKGYLSEVVDEYDLKKKIHFKHRVLAANYDTASKKWYVEIEDAAQKKQTWIANFIVGCTGYYNYDQGFEPDFPNKDAFKGQFIHPQHWPENLDYVGKKVVIIGSGATAITLVPAMSKGGAEHVTMLQRSPTYIASIPSIDFVYDKMRKVLPEDLAYKLTRARNIGVQRGIYTLSQKQPKLVRKFLLKSIEMQLKGKVDMKHFTPSYNPWDQRLCVVPDGDLFKILRSGQASVETDQIEKFTETGIQLKSGKHLDADIVVSATGLEIQILGGIKGTIDGQPLDTSKSMLYQGVMVSDVPNMAMIIGYINASWTLKVDVAADYICRLLNYMDKQGYDEVIPEGDQTELMEDTVMGSLTSGYIARAANVMPKQGKHAPWKVTNNYLADRKALKNARFDDGVLHFDKKTDTVERKTKPKLVS

55.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make almA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here