Description
E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Inhibits neurogenesis and axis formation during embryonic development by modulating the phosphatidylinositol 3-kinase (PI3K) pathway. Acts downstream of PI3K and akt1 to up-regulate gsk3b mRNA expression.
Sequence
MTTKQVTCRYFLHGVCREGNHCQFSHDPSSSKPSTICKFYQRGTCAYGERCRYDHVKLSSRGGGAFDMAGVGGARDGASTRGAAKKTFVHQERENMFRAPAESFGADVMAPAPHTYVDAIRTGLSSSSQDHTPPTMAGVNQDLPRLCPYAAVGHCYYEENCIYLHGDKCEVCGLQVLDPHNPEQRSMHEKMCLLAFEADMEKAFAVQLSQEKVCSICMEVVVQKMNPSDRRFGILSSCCHVFCLACIRKWRCTRNFSNKIIKSCPECRVASEFVIPSVYWEENQEDKVHLIELFKSGVGKKPCKYFDQGRGSCPFGGKCLYLHALPDGSRAEPEQPRKQLGSEGNIRFMNSVRLWDFIEEREQHSAPPLQAFADDISELRELFVQMSGPSPDEGESQSRSAP
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service