E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Inhibits neurogenesis and axis formation during embryonic development by modulating the phosphatidylinositol 3-kinase (PI3K) pathway. Acts downstream of PI3K and akt1 to up-regulate gsk3b mRNA expression.

423 amino acids

MSTKQVTCRYFLHGVCREGSRCLFSHDLNNSKPSTICKFYQRGVCAYGERCRYDHIKPSSRGGGGGAPEDQAGGGGAGGGGAGIGGAGGGPSVRGGMKKNLVLRDRVLGVDRVDRMFGAPADSMWSDVSTAAAPHSYVEAIRTGLDASAQDQATPPVCGPSQNLPQLCPYAANGHCFYEENCTYLHGDLCEVCGLQVLHPHDSEQRRAHEKMCLAAFEADMEKAFAAQLSQDKVCSICMEVVVQKANPSDRRFGILSSCCHTFCLACIRKWRCTRTFSNTIIKSCPECRVVSEFVIPSVYWVEDQEDKDHLIDLFKSGVSKKACKYFDQGRGSCPFGGKCLYLHAFPDGTRAEPDRPRKQLSSEGNVRFMNSVRLWDFIEEREQRSVPPLPALDDDMAELRELFMQMSGPSHDGPETPPTADQ

46.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mkrn2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here