Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Functions as a ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity (By similarity).

Belongs to the Deltex family.

619 amino acids

MAMAPSSSLPQVYPSHVVVAVWEWQDGLGIWHPYSATVCSFIEQHFVRQRGQHFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQNTGTMRSVRRHLFSQNSAPGQGIVWEWLGDDGSWVAYEARICDYLEQQVARGIQVVDLAPLGYNYTVNYATLTQTNKTSSFCRSVRRQVGPVYPVTSDIAVPRQMGLICFCQQCLHGSGTGPVSGRYRHSMTNLPAYPAPQAPHRTTTVSGAHQAFAPYNKPSLSGARSAPRLNTTNPWAAAPPVAGNQSLFHSSLSHLGPQLLPSGPSTSSGASASFPSGPSSSSPGSAPTTVPVQMPKASRVQQALAGMTSVLSAIGLPVCLSRAPRPTGPPASRPASKSHSSVKRLRKMSVKEGAPKPEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPWGKMEVFRFQMSLPGHEDCGTILIVYNIPHGIQGPEHPSPGKPFTARGFPRQCYLPDSPQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ

67.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Dtx2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here