Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.

Belongs to the RBR family. Ariadne subfamily.

514 amino acids

MDYSDDDMIDNESGEENNSDGGGNESYNYNAAVDTIILSEKSYVIIKEEEILKLQRDDIERVSTILFLSQVEAIVLLLHYHWCVSKLEDEWFTDEERIRKTVGILKEPVVDVNGTEVDIQCGICFESYTRKEIASVSCGHPYCKTCWTGYITTKIEDGPGCLRVKCPEPSCYAVVGQDMIDEVTEKKDKDKYYRYFLRSYVEDGKKMKWCPSPGCECAVEFGESSGYDVACLCSYRFCWNCSEDAHSPVDCETVSKWIFKNQDESENKNWILANSKPCPKCKRPIEKSHGCNHMTCSASCGHRFCWICGKSYSDHYACNNYVEDADHDKRTLLQSEIKRYTHYYVRWVENQSSRLKAMSDLEKFQSVQLKQLSDNQCKPKIDLQFIVDAWLQIIECRRVLKWTYAYGYYLDNLAKRPLFEYLQGEAETGLERLHHCAENELKQFFIKSEDPSDTFNAFRMKLTGLTKVTKTYFDNLVKALENGLADVTKSSEESADFLETQKLYDAYISEGCFF

59.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARI10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here