SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination.

307 amino acids

MASWVFCNRCFQSPHRKSSFSLTSCGHVYCHSCLLKGTKNECVICQAPCQTVLLSKHTNSNIQTFFLGIDGLCKKYSQETSQISEFQEKHRRRLVAFYQEKISQLEESLRKSVLQIKQLQSMRSSQQPAFNKIKNSVSTKPNGYLFLPPNSSLPDRIESMDIDLTPPARKPEMSAGPSRISVISPPQDGRMGSVTCRGPQHLSLTPSHASMTKASRVPPLQMPYKELSPPPASQLSSRATQGPSPSVSSSWTGPPRQPISISGLLQRQCAGSASPRGMDTEKMSPFLPSTPTNLRSVASPWHACVHR

33.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Rnf212 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here