Probably part of the binding-protein-dependent transport system y4oPQRS. This system probably transports a sugar-like molecule. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family. MalFG subfamily.

309 amino acids

MTISQTVPRGAVAVRRRRRIRISTVVWFTMPAAAIMLLVLGVPLVYSFYYSLTGWSLVVPGSDQDFIGLLNYTDVLRSSEFWAAIRVTLIYAVVAVSLECALGILFAVLLNLEFFGRGLFRSLMLIPMVITPAVVGIFWKLLYEQDSGVFNYLLGTLGFEPVPWLSLTVALASVIIVDVWQSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVFRYLTLPHLVPYIMIAAAFRIIGVMADFDKIFLLTLGGPGNVTTTLSVYAYNTGFKVFDIGRTTAISWIYVVFVLAISAPLIWRLFRGASVNRH

34.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NGR_a02190 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here