Purine nucleoside phosphorylase which is highly specific for 6-oxopurine nucleosides. Cleaves guanosine or inosine to respective bases and sugar-1-phosphate molecules. Involved in purine salvage.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

260 amino acids

MRIAIIGGSGVYDPGILTNIHEERVETPYGAAVLKVGTYHGEEIGFMPRHGDKHTVPPHKVNYRANIWALKMLKVERVLATAAVGSTNPEFRPGDFVIVNDFLDFTKTRTYTFFEGGETGVVHTDFTTPYCPELGQVLVETAARLGIKAHAGGVYACTEGPRFETPAEIRMIRQLGGDLVGMTNVPEVVLAHEVGLCYGLIAMVTNMAAGISSTPLSHEEVLEIMDQNGKNLRDLIMQAIPGIPRQRNCRCSLAAGKIEV

28.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Moth_0705 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here