Catalyzes the release of the completed linear polyketide from the rif PKS by forming an intramolecular amide bond, in this way terminating polyketide assembly and forming the macrocyclic compound proansamycin X, an intermediate in the rifamycin B biosynthesis.

Belongs to the arylamine N-acetyltransferase family.

260 amino acids

MNVFDVETYLQRIGCGGETGVDLETLAKLQKSHLMAIPYSSLAYELRDAVNVVDLDEDDVFVTSIAEGQGGACYHLNRLFHRLLTELGYDVTPLAGSTAEGRETFGTDVEHMFNLVTLDGADWLVDVGYPGPTYVEPLAVSPAVQTQYGSQFRLVEQETGYALQRRGAVTRWSVVYTFTTQPRQWSDWKELEDNFRALVGDTTRTDTQETLCGRAFANGQVFLRQRRYLTVENGREQVRTITDDDEFRALVSRVLSGDHG

29.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rifF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here