Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH.

Belongs to the MCH family.

132 amino acids

MRDSVLSVIFALALFLECYTPSMAIPMGKMEDTALEQDTLDSLLNESVADKNPDSVRSGSSKIIVLADSGMWKNLNRGLPLYKLKAAAAGLDRALTLDRREADQDLSPSISIVRRDTMRCMVGRVYRPCWEV

14.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mch1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here