Plays an essential role in viral DNA replication. Does not seem to participate in the initiation step but is rather important for the amplification of DNA. Also required for expression from the vp39 and polh promoters.

Belongs to the baculoviridae LEF-2 family.

210 amino acids

MANASYNVWSPLIRASCLDKKATYLIDPDDFIDKLTLTPYTVFYNGGVLVKISGLRLYMLLTAPPTINEIKNSNFKKRSKRNICMKECVEGKKNVVDMLNNKINMPPCIKKILNDLKENNVPRGGMYRKRFILNCYIANVVSCAKCENRCLIKALTHFYNHDSKCVGEVMHLLIKSQDVYKPPNCQKMKTVDKLCPFAGNCKGLNPICNY

23.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make LEF-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here