Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors. Requires the other members of the gamma-secretase complex to have a protease activity (By similarity).

Belongs to the peptidase A22A family.

473 amino acids

MSSDNNNDPFDLNEDGHDYFNRVSTTTSPNRQSINSSPKQSSPKSTNNNDDKNNIILDLNDNNNDNNNTNNYNDEDIDVDNKNKFENKDNTYNSNGGSNNKNKNKKKDNKSNNSSDNEEADENTSLISDSEPLLNKKEKDDEQIEIENLDGEDYDDEVSLQDFSSMIVSIIIPVSITMMAVVFFVKYLNNQTLYASTLSYTIAGGSSGGGSGADSITGNSFVDSLIVAGIVLGMIIVTTVAFVLLYKYRCLKILYGWLFLSVGMMLGSFGTTFFQAMLSAANLPLDYITFAFLIFNFTVCGIIGVFWYAHQYVNQLYLVIISVLMAISLTRLPQWTIFTLLVIVAIYDLFAVLCPRGPLKVLVELSQERNENIPALVYETGKGSDSNLKLGLGDFIFYSLLISRAALVHMSCVFSTFIAILTGLFLTLLCLAIFKKALPALPISIFLGILFYYLSNNFLTPFIEALTLSQIFV

52.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make psenB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here