Involved in the import/insertion pathway in the thylakoids. The signal recognition particle is not involved in the insertion of SECE1 in the thylakoid membrane.

Belongs to the SecE/SEC61-gamma family.

177 amino acids

MSLTAQFSPPVTGITRSLRDTKPSLSNLRVFPVYTEIRTMTTSNLRKSACFVAKAIEQRRDTAGSESESEATPSPAEESGSGEDKEVEISAIGAEIKAAMEQRKTAEEEKGKNEFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVIAGSSVVLLTVNFLLAELSDRVFIGRGVQDFFS

19.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SECE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here