Prenyl transferase; part of the ATM1 gene cluster that mediates the biosynthesis of aflatrem, a tremorgenic mycotoxin with acute neurotoxic effects (PubMed:19801473, PubMed:2867895). Synthesis of geranylgeranyl diphosphate (GGPP) by AtmG (a GGPP synthase) precedes condensation of GGPP with indole 3-glycerol phosphate, followed by epoxidation and cyclization by AtmM (a FAD-dependent monooxygenase) and AtmC (a prenyltransferase) to produce paspaline (PubMed:19801473). AtmB is also essential for paspaline production, but its exact role has not been identified yet (PubMed:19801473). AtmP, a cytochrome P450 monooxygenase, subsequently converts paspaline to 13-desoxypaxilline via PC-M6 by removal of the C-30 methyl group and oxidation at C-10 (PubMed:19801473). AtmQ, a cytochrome P450 monooxygenase, then catalyzes the oxidation of 13-desoxypaxilline, first at C-7 to produce paspalicine and then at C-13 to form paspalinine (PubMed:19801473). Finally, AtmD prenylates paspalinine to form aflatrem (PubMed:19801473).

Belongs to the FPP/GGPP synthase family.

334 amino acids

MGFFHDFLSRPTTYAILAVLVIPVTALAWDRLPPLLPSAKRLLVGKKNPSKITSLECPYSYIRQIYGTHHWAPFVDKLSPSLKTERPAKYHMILEIMDGIHLCLMLVDDISDGSDYRKGRPAAHHIYGPSETANRAYYRVTQLLNRTGHEFPELAPWLLQCLEEILEGQDLSLVWRRDGLSAFPVQPEERVAAYRQMAYLKTGALFRLVGQLVLENQSYDDTLSTVAWYSQLQNDCKNVYSSDYAKAKGAIAEDLRNGELSYPIVVALNVPKGQYVVPALEFRSPHNIRQALRVIQSDQVRNICLTEMKKSAVSIQDWLALWGRNEKMDMKSEK

38.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make atmC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here