About Products Protein Database Contact

Protein expression services for PRP28 | Pre-mRNA-splicing ATP-dependent RNA helicase PRP28

Description
ATP-dependent RNA helicase involved in mRNA splicing. May destabilize the U1/5'-splice site duplex to permit an effective competition for the 5'-splice site by the U6 snRNA, resulting in the switch between U1 and U6 at the 5'-splice site. May also act to unwind the U4/U6 base-pairing interaction in the U4/U6/U5 snRNP, facilitating the first covalent step of splicing (By similarity).
Family
Belongs to the DEAD box helicase family. DDX23/PRP28 subfamily.
Species
Candida albicans (strain SC5314 / ATCC MYA-2876)
Length
581 amino acids
Sequence
MSSNIFKRFKSAEESLDEDESVTPVYIPKAKRAKLEALKAKKSQIASRLSTHKQQSAPTTTTNTSTTASTTTTATTNNTNNSKPSIQTKKPTGKKFQFDWDVEEEDTASGFVPLIEMDEEIDDPLFSGQESTHWTNKNLEEMTDRDWRIFKEDYNITTKGKNIPNPLRYWNEGSINDKLVSIISQLGYEEPTSVQRASIPLALKKRDVVGVAETGSGKTLAFLIPVLNYILSIDENYLKYEKISNEPVGLILAPTRELALQITKEAEKFCKKLGYQVLPIIGGHHYQDTINKIDQTGVHLIVATPGRLVDSIERKIVDLSKCYCLVMDEADRMIDMGFEKDLNKVLDKLPTEKQLSSTIDGRIFHLEKRSTMMFTATISPTVEKLTKKYLIDPGYLYIGGAGEALDNISQSFEFLSSATTEATKFNKLIKIIRSHWRVTENPLIIIFANFKHVCDSLSQELSSNDINNVVIHGSKSQDMREQAITNFRNHESEVLIATDVAARGIDIPNVTLVINYQMVKKFDEYIHRIGRTGRAGNLGESFTFISDQDTEIFTPLKKFLKKGGKRLPDWLYKHQSQTVQE
Mass
65.6 kDa
Simulated SDS-PAGE
Western blot of PRP28 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make PRP28 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here