Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Belongs to the arenaviridae GPC protein family.

488 amino acids

MGQLFSFFEEVPNIIHEAINIALIAVSLIAALKGMINLWKSGLFQLIFFLTLAGRSCSFRIGRSTELQNITFDMLKVFEDHPTSCMVNHSTYYVHENKNATWCLEVSVTDVTLLMAEHDRQVLNNLSNCVHPAVEHRSRMVGLLEWIFRALKYDFNHDPTPLCQKQTSTVNETRVQINITEGFGSHGFEDTILQRLGVLFGSRIAFSNIQDLGKKRFLLIRNSTWKNQCEMNHVNSMHLMLANAGRSSGSRRPLGIFSWTITDAVGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLDHDSEFCDMLKLFEFNKKAIETLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLNTPYCNYTKFWYVNHTASGEHSLPRCWLVRNNSYLNESEFRNDWIIESDHLLSEMLNKEYIDRQGKTPLTLVDICFWSTLFFTTTLFLHLVGFPTHRHIRGEPCPLPHRLNSRGGCRCGKYPELKKPITWHKNH

56.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GPC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here