Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding (By similarity).

Belongs to the prefoldin subunit alpha family.

151 amino acids

MAQQMPSPEEIAAQLQMIRDQIAELQGVLAQLELRLRSVQAAKETVEKAAGQDGETLFPGDPELNTILKARLLEPGKAIVHLGLNVYAKLDTAKATEILAKKEDALKRSLETLKQELDKLSRTHDQYLQLLQALTAGQAAQQAGQQQKQGS

16.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pfdA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here