Nuclease that is responsible for viral evasion of host cGAS-STING innate immunity (By similarity). Cleaves 2',3'-cGAMP which is produced by host cGAS following recognition of intracellular foreign DNA and blocks the subsequent 2',3'-cGAMP-mediated activation of TMEM173/STING which normally spreads to adjacent cells and activates the interferon and NF-kappa-B immune responses (By similarity).

Belongs to the poxin family.

219 amino acids

MAMFYAHALGGYDENLHAFPGISSTVANDVRKYSVVSVYNNKYDIVKDKYMWCYSQVNKRYIGALLPMFECNEYLQIGDPIHDQEGNQISIITYRHKNYYALSGIGYESLDLCLEGVGIHHHVLETGNAVYGKVQHDYSTIKEKAKEMSTLSPGPIIDYHVWIGDCICQVTAVDVHGKEIMRMRFKKGAVLPIPNLVKVKLGENDTENLSSTISAAPSR

24.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make B2R using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here