About Products Protein Database Contact

Protein expression services for kdpA | Potassium-transporting ATPase potassium-binding subunit

Description
Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit binds and transports the potassium across the cytoplasmic membrane (By similarity). The Kdp system is essential for growth under K(+) limitation, and for survival under desiccation and salt crystal inclusion (PubMed:18633573, PubMed:23757278).
Family
Belongs to the KdpA family.
Species
Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Length
582 amino acids
Sequence
MASPPPIVEYAVFFTILAVLVFVAGEYLAWVYREQANSDHRPPGYLSWFERLDEIFTPIENGLYRLSGINPRREMTWKGYLKAVLVFNVCIWVLLFVVLMFQDALPMNFVGVGGESWDLAFHTASSFTSNTNQQHYSGETLSVFTHTFGIGIAMFLTPATGLALMPAFARAFTNKEDPRLGNFYENVVRGLVRFLLPISLLIAIILMAEGSVQTILGGQLTANTFTMGIQNIRIGPHAGIEAIKMFGTNGGGINAANAATAFENPTPLSNLVLTLAMPIGTFSAIYAWGAWVGNRSHGVAIVAAFFVIYMALTGVAVVGETGTNAGMVVTGNGLHVDQTVGNMEGKETRFGPTASAIWGLSTTGTTNGGVNSMHNSWTALGAFSLLFAFATNNISNGVGTGLLNILMFVILTAFIGALMIGRRPQYLGKKLEWQEMRYVFVVILVLPILVLIPQAAAVVYQGAIDSMNNPGFRGFSEVLYEFFSASANNGSGFEGLGDGTLFFNLVNGVQVLLARYVPITAQLAIAGYLANKKVSPESKGSLDTDTPAFVGLLIGVIIIVSALVFLPALVFGPIGELLSGGI
Mass
62.4 kDa
Simulated SDS-PAGE
Western blot of kdpA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make kdpA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here