Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit binds and transports the potassium across the cytoplasmic membrane.

Belongs to the KdpA family.

590 amino acids

MTVNGWLQIGIFIAAVLLGAKPLGVYMAAVFERRHTWLDPVLVPVEKLLYRLTAVKAEEEMHWTAYCASMLIFSAATMLLTYLIERVQQFLPLNPQHLGGVPAQLAWNTAISFTTNTNWQAYTPESTMSYLTQMVGLATHNFWSAAVGIALAIAFIRGIARKEMKTLGNFWVDMTRAILWVLLPICVVFALVLTSQGVIQNLKSYTVAHVVQPQSQTQTVNGKTVTTTDSTQTIAQGPVASQEAIKMLGTNGGGFFNANSSHPFENPTPLSNMLEMISIFLIPAGLTVTLGQMTGSPRHGWAVLGAMLILWFAGVATCYWAEAQPNPLFHGVNQQATALQAGGNMEGKEVRFGIADSALFATVTTDASCGAVNAMHDSFMPLGGMVPLTNIMLGEIVFGGVGAGLYGMLVFVIVAVFIAGLMVGRTPEYLGNKIQAYDVQMAMLYLLIFPLIILGFSAVAVLTPHLGLPSISNPGPHGLTQILYAYSSATGNNGSAFAGLNANTSWYNLSLGFAMFIGRFLMIVPMLALAGNLAQKKNVPETLGTFPVTTPLFTVLLTSVIIVVGALTFLPALSLGPILEHLLLQAGRTF

63.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make kdpA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here