Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.

Belongs to the KdpC family.

198 amino acids

MKIIRKSILAVLVFTILCGIIYPVSTTVLAQVLFKEEANGSIIEVDGKKYGSELLGQQFTDNKYLWGRIMNINVEMFKDSNGKPLMYSSPSNLSPASEEYEKLVKERVERIRSYNKGKEEEPIPVDLVTSSGSGLDPHISVAAAKYQVDRIAKERNLSVDYVNEIIDKYTTGRFLGIFGEKTVNVLKVNLALDGILRE

22.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make kdpC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here