Description
Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.
Family
Belongs to the KdpC family.
Sequence
MSYLRPALVLLILLTLITGIAYPLLTTGLAHLMFSQQASGSLARLGDNVVGSTLIGQNFTQPGYFTGRPSATADRPYNPMASGGSNLASSNPALGQAIGERVKLQRQANPTQLGPVPVDLVTASGSGLDPHISLAAAYYQAPRIASIRQMPLSDVQQLIDNSMQKAIPSFFGEPVVNVLNLNMALDSHSHVKVPANPAKP
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service