About Products Protein Database Contact

Protein expression services for kdpC | Potassium-transporting ATPase KdpC subunit

Description
Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.
Family
Belongs to the KdpC family.
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Length
190 amino acids
Sequence
MSNVLRPALSLIVLMSLITGVAYPLVVTGVAQVAFPAQANGSLVYDAAGKVRGSALIAQSFTGDEWFQSRPSAGAFATVASGASNFAPSNPALVTRVKEDVAKLANASQEPVPLALLTTSGSGLDPHLSPEAIAWQAGRVAAARQLPLEKVQALIDANTQRPLIGPPVVNVLALNMSLNQLPSAPRNAQL
Mass
19.6 kDa
Simulated SDS-PAGE
Western blot of kdpC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make kdpC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here