Probable inward-rectifying potassium channel. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization (By similarity).

Belongs to the potassium channel family. Plant (TC 1.A.1.4) subfamily.

502 amino acids

MPRSSRMNLWPHCFPCFDDGDRSGNRFSTVCNFPDDLLPSLGATAHQPPKLRKYLVSPYDPRYKVWETFLIILVVYSAWICPLEFAFLRYLPSAPFVVDDVVNGFFAVDIMLTFFVPFVDKKSYLLVNDPKKIAVRYLSSWFVFDVCSTVPFHSISLLFNEHGHDLGFKFLNVLRLWRLRRVSSMFARLEKDIRFNYAVIRCTKLISVTLFAIHCAGCINYLIADRYPDPRRTWIGAVMPNFREDGLWIRYVTAMYWSITTLTTTGYGDLHAENAREMLFGICYMLFNLWLTAYLIGNMTNLVVHSTSRTRDFRDVVQAASEFAARNQLPQQIEEQMLNHICLRYKTDGLKQQETLDVLPKAMRSSISHYLFFRVVQGAYLFKGVSSRFIQQLVTEMQAEYFAPKEDIILQNDSPSDLYLLVSGAVDILVFLDGTEQVYRRAAEGELLGEIGVLCNKPQSFTFRTTKLSQILRISRTKLLGIIQENREDGDIIRSNLQQVNV

58 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Os01g0756700 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here