About Products Protein Database Contact

Protein expression services for kbp | Potassium binding protein Kbp

Description
Highly specific potassium binding protein that is required for normal growth in the presence of high levels of external K(+). May act as a sensor of cytoplasmic K(+) concentration. Binds a single K(+) ion, which induces a large conformational change. Can also bind the larger alkali metal ions Rb(+) and Cs(+), and NH(4)(+) (PubMed:27112601). May be involved in the regulation of peptidoglycan cross-linking (PubMed:25422305).
Species
Escherichia coli (strain K12)
Length
149 amino acids
Sequence
MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE
Mass
16.1 kDa
Simulated SDS-PAGE
Western blot of kbp recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make kbp using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here