Important for striated muscle differentiation and cardiac morphogenesis. Is also required for cardiac conduction system development, plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding.

Belongs to the popeye family.

370 amino acids

MNSGDSSLIDAVIYNHTLCDGWTNSTEGAIYHLGNTILFLGYMGGSGAYGALYIFSFLAPAFLCLALWGWLTMCGLDVFIWNLLLMLQCLAQVCHLIFRLMRDGLANEEFSALYTAVYLPLDVPVQVFKEITGAGENKVLSLAAEETYAVEGKTPIDQLSFLLSGRIRVSLEGQFLHYIFPHQFLDSPEWESLRPAEEGNFQVTLTAETDCRYISWRRRRLYLLLSKDRYIARLFSVMLGSDIADKLYSLNDKLFAKSGVRLDIRLPSLYHVLAPSPPGSEGGSASSPPRGSLGDPTVIKVDPAPSNPGSGTRNPQPDQGKNPVPKNPHQHWSSDTEMPSGEDSTSLILEDFADMTGSLMDYGHEREYLK

41 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make popdc2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here