Description
Enzyme involved in the degradation of lignocellulosic biomass. Hydrolyzes weakly barley beta-glucan, carboxymethyl cellulose, lichenan, wheat arabinoxylan and birchwood xylan. Stimulates the hydrolysis of lignocellulosic substrates (such as hydrothermal pretreated wheat straw or steam-pretreated spruce), when combined with other cellulolytic enzymes. Lignin is a significant source of reductant residues that probably stimulate GH-61 activity by acting as electron donors.
Family
Belongs to the glycosyl hydrolase 61 family.
Species
Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799)
Sequence
MSKASALLAGLTGAALVAAHGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPESHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKAGNYVLRHEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYSQCL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service