Enzyme involved in the degradation of lignocellulosic biomass. Hydrolyzes weakly barley beta-glucan, carboxymethyl cellulose, lichenan, wheat arabinoxylan and birchwood xylan. Stimulates the hydrolysis of lignocellulosic substrates (such as hydrothermal pretreated wheat straw or steam-pretreated spruce), when combined with other cellulolytic enzymes. Lignin is a significant source of reductant residues that probably stimulate GH-61 activity by acting as electron donors.

Belongs to the glycosyl hydrolase 61 family.

342 amino acids

MSKASALLAGLTGAALVAAHGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPESHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKAGNYVLRHEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYSQCL

34.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Cel61a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here