Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides (By similarity).

Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.

622 amino acids

MRLLRRRHMSLRLAMLGSVFMLFLFIRQKDVSNQEQAMEKPWLKSLAGQKDQVLDFMLGAVNNIRDVMPKLQIRAPEPPQTLVSTNHSCLPGFYTPAELKPFWDRPPQDPNSPGADGKAFQKKEWTNLETKEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPAILLKEIILVDDASTDEHLKERLEQYVQQLQIVRVVRQRERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAVVSPDIVTIDLNTFQFSRPVQRGKAHSRGNFDWSLTFGWEMLPEHEKQRRKDETYPIKSPTFAGGLFSISKAYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDDYKKIFYRRNLQAAKMVQENNFGDISERLRLREQLRCHNFSWYLHNVYPEMFVPDLNPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYVCHNLGGNQYFEYTSQRDLRHNIGKQLCLHASGSTLGLRSCQFVGKNSRVPKDEEWELTQDQLIRNSGSGTCLTSQDKKPAMAPCNPRDPYQLWLFV

71.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Galnt6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here