Polypeptide N-acetylgalactosaminyltransferase that catalyzes the initiation of protein O-linked glycosylation and is involved in left/right asymmetry by mediating O-glycosylation of NOTCH1. O-glycosylation of NOTCH1 promotes activation of NOTCH1, modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO). Polypeptide N-acetylgalactosaminyltransferases catalyze the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward MUC1, MUC4, and EA2 than GALNT1. Not involved in glycosylation of erythropoietin (EPO) (By similarity).

Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.

608 amino acids

MGSITVRYFCYGCLFTSATWTVLLFIYFNFSEVTQPLRNVPIKGSGPHGPFPKKFYPRFTRGPGRVLDPQFKANRIDRLMNNHIEDPDKGLSKSSSELGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYPTDLPTASIVICFYNEAFSALLRTVHSVVDRTPAHLLHEIILVDDSSDFDDLKGELDEYIQRYLPAKVKVIRNMKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAIILEDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHFKWDLVPVSELGGPDGATAPIRSPTMAGGLFAMNRQYFNDLGQYDSGMDIWGGENLEISFRIWMCGGKLFILPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPDLKNKSFGNISERVELRKKLGCQSFKWYLDNIYPEMQIPGPNAKPQQPVLINRGPKRPRVLQRGRLYHLQTNKCLVAQGRSSQKGGLVLLKTCDYGDPTQVWIYNEDHELILNNLLCLDMSETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRVMDLMDQKGYVGMAICDGSSSQQWRLEG

69.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Galnt11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here