Polynucleotide 5'-kinase involved in rRNA processing. Required for the efficient termination by RNA polymerase I and the processing of the IST2 pre-rRNA internal transcribed spacer localized between the 5.8S and 25S rRNAs. May act by maintaining the phosphorylated status of the downstream RNT1 cleavage product, which in turn allows the torpedo activity of RAT1 to efficiently terminate Pol I transcription. In vitro, displays polynucleotide kinase activity on both single- and double-stranded RNA and on single-stranded DNA alone, but not double-stranded DNA alone.

Belongs to the Clp1 family. NOL9/GRC3 subfamily.

632 amino acids

MVIDSKQDLPQYTKDSGSESDSDSSNNFIVESPSIPSSKSATVVLNSEEYEDDEGDDLNGLDAELIDNITYEGDEDETMFVGLKEKQKLHLSGVFRLQVVKGGIVYNNVHYNASREILTFWHPLSQSIPTIDFSHFAGWQDTFFMPRNNRFKIRDEEFKSFPCVLRVFNSNHTGLLEAGHLYRDVNYLWKPKEPYFPLNERTTYHLLHESDRIQSLSVPGYWSTPLEKLYLSHKNAAYDTRIMVIGGKNSGKSTFLRLLLEKFTQDIRDSTTSQEELVYLDLDPGQPEYSLPDSISLNKILSSPISLGQHLCQGSNFQTLLQFYAGSSSPQDEPTSYLNCADKLIDHLEEQAFFGTSLLNLPGWIKGFGMQILNHIIRKYKPTHLLFLETANSKRHLDELTIPQSFSTSLRDAYAPEVVRVPAHSLNHTLSSRFHASQLRTFKILALFHKITQFDYDFAPLLKSAPLQISYGKGKSGIKGIQFPMEFQDLNPQDIKSALEGTVIGIYTYSGEDSLEVKSLNTFPILQSCTSSSKNFITLGLIHSIDTSQQIMNIYVPPCHTQILDKQPEDAQWIIVRNKTETPFCDFLPSPRTITWDDNIQIPFATFERRKKLEHVWKVRKNVMRRGQFMKR

72.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GRC3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here