About Products Protein Database Contact

Protein expression services for Pqbp1 | Polyglutamine-binding protein 1

Description
Intrinsically disordered protein that acts as a scaffold, and which is involved in different processes, such as pre-mRNA splicing, transcription regulation, innate immunity and neuron development. Interacts with splicing-related factors via the intrinsically disordered region and regulates alternative splicing of target pre-mRNA species. May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery. May be involved in ATXN1 mutant-induced cell death. The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit. Involved in the assembly of cytoplasmic stress granule, possibly by participating to the transport of neuronal RNA granules. Also acts as an innate immune sensor of infection by retroviruses, by detecting the presence of reverse-transcribed DNA in the cytosol. Directly binds retroviral reverse-transcribed DNA in the cytosol and interacts with CGAS, leading to activate the cGAS-STING signaling pathway, triggering type-I interferon production.
Species
Rattus norvegicus
Length
263 amino acids
Sequence
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRIEGLPPSWYKVFDPSCGLPYYWNVETDLVSWLSPHDPNFVVSKSAKKLRNSNADAEDKSERNLEKVDRNHEKSDRSHEKPDRSHEKADRNHEKSDRERERNYDKVDRERDRDRERERAFDKADREDGKDRRHHRREELAPYPKNKKATSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRSKQQD
Mass
30.5 kDa
Simulated SDS-PAGE
Western blot of Pqbp1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Pqbp1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here