Polymerase that creates the 3'-poly(A) tail of mRNA's. May acquire specificity through interaction with a cleavage and polyadenylation factor (By similarity).

Belongs to the poly(A) polymerase family.

555 amino acids

MNNQAYGVTPPISVANSTPKENELNDSLIKELKSRGSFESETATKKRVEVLNILQSMTEEFVYKVSIKKNISEGMARDVGGKIFTFGSYRLGVYGPGSDIDTLVVVPKHVSRNDFFEVFYELLKGRSELEEIAPVPDAFVPIIKIEFAGISIDLIFARLDIPRVPRDLTLDDKNLLKNIDEKDLRALNGTRVTDEILQLVPKPTVFKHALRCIKMWAQQRAVYGNIFGFPGGVAWAMLVARICQLYPNAVSAVIVEKFFHIYSQWAWPQPVLLKQIEDGPLQVRVWNPRLYALDRQHRMPVITPAYPSMCATHNITSSTQKVILSEFQRGIELMNDINVGKKSWSDLLERHDFFFRYKFYLCIVAATRSTYAEHLKYSGMVESKLRLLVQKLELVEGIELAHPYVKSFENGYYCDNAEEAHEIMNLYGTSKGDDRVKGVLHAENNDNNKENVENKVELHMTKLFIGLKLDLSKEGEKKLDIQYPCAEFFNICKGWQDFDSEKHFIQIKNVKLYDLSDDVYVDGETRPIKIAKRKRAVSKNEGKKKPKSVGTVSAA

63.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PAPA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here