Protein expression services for phaE | Poly(3-hydroxyalkanoate) polymerase subunit PhaE
Description
Involved in the production of polyhydroxyalkonic acids (PHAs), which are water-insoluble biopolymers used as intracellular energy reserve material when cells grow under conditions of nutrient limitation. PHAs are composed primarily of 3-hydroxybutyric acid (3HB) and 3-hydroxyvaleric acid (3HV). Required for the production of poly-beta-hydroxybutyrate (PHB) and poly(beta-hydroxybutyrate-co-beta-hydroxyvalerate) (PHBV).
Family
Belongs to the PHA/PHB synthase family.
Species
Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Length
181 amino acids
Sequence
MSNTNNIQEEWTEMVEEMNNAVADSMEQNMKAQAAFVESWADAVEDTIPEQDDLADGMDGYNRAYEEWMDAAEQMVERSTDAAQGEDVDPAEFRDIWLQSANEAFKHVMGTSAFAAANGQLVESMMEMQQEADDLSQDTLEQLGFPTRNDVDEIAERLIELERRQHAVEQKLDRVLEHLEE
Mass
20.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make phaE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here