Specific for poly(hydroxyalkanoic acid) consisting of monomers of four or five carbon atoms and for P-nitrophenylbutyrate as substrates.

Belongs to the AB hydrolase superfamily. Lipase family.

414 amino acids

MLAKQIKKANSRSTLLRKSLLFAAPIILAVSSSSVYALTQVSNFGTNPGNLQMFKHVPSGMPANAPLVVALHGCTQTAAAYEASGWSALGNTHKFYVVYPQQQSGNNSNKCFNWFEPGDITRGQGEALSIKQMVDNMKANHSIDPSRVYVTGLSAGAFMTTVMAATYPDVFAGAAPIAGGPYKCATSMTSAFTCMSPGVDKTPAAWGDLARGGYSGYNGPKPKISIWHGSSDYTVAPANQNETVEQFTNYHGIDQTPDVSDTVGGFPHKVYKSANGTPLVETYTITGMGHGTPVDPGTGANQCGTAGAYILDVNVCSSYYIGQFFGIIGGGGTTTTTTSGNVTTTTAATTTTTTATQGYTQTTSATVTNHYVAGRINVTQYNVLGARYGYVTTIPLYYCPSLSGWTDKANCSPI

43.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make phaZ1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here