Essential protein that is involved in the control of cell division, probably through the regulation of ctrA. Its phosphorylation status is regulated by PdhS (By similarity).

123 amino acids

MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYLGDA

14 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make divK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here