Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation.

Belongs to the intercrine alpha (chemokine CxC) family.

105 amino acids

MSAAAVFRGLRPSPELLLLGLLLLPAVVAVTRASPEESDGDLSCVCVKTSSSRIHLKRITSLEVIKAGPHCAVPQLIATLKNGSKICLDRQVPLYKKIIKKLLES

11.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Pf4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here