Might play a role in defense against invading genetic elements, using short DNA sequences as guides to bind complementary target strands, resulting in slicing of the target nucleic acid (By similarity). Binds nucleic acids with decreasing affinity in the following order; ssDNA, ssRNA, dsDNA, RNA-DNA, RNA-RNA (PubMed:15800629). Association of the 5' seed region of the guide strand (nucleotides 2-7) with AfPiwi increases affinity for the corresponding target strand; the greatest increase in affinity is for guide DNA with target RNA (PubMed:19187762).

Belongs to the argonaute family. Short pAgo subfamily.

427 amino acids

MMEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPNNRFHPYEGTKVKLSSKRYLLTLLQPYLKRNGLEMVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL

49.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AF_1318 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here