Transcriptional coregulator of NF-kappa-B which facilitates binding of NF-kappa-B proteins to target kappa-B genes in a redox-state-dependent manner. May be required for efficient terminal myeloid maturation of hematopoietic cells. Has quercetin 2,3-dioxygenase activity (in vitro) (By similarity).

Belongs to the pirin family.

290 amino acids

MASSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGKPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHVGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRRSEKMVAPQYQELKSEEIPKPTKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDQGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDAVQLENKDPKRSHFVLIAGEPLREPVVQHGPFVMNTNEEISQAILDFRNAKNGFEGARTWKSKIGN

32.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Pir using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here