Part of a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of folded proteins across the outer membrane (Probable). Required for correct assembly of the type II secretion system-beta (T2SS-beta), for localization of GspD-beta to the cell outer membrane and for export of a labile entertoxin by T2SS-beta (PubMed:22585966). Each AspS2 binds to 2 GspD2 subunits and may clamp the monomers together, stabilizing structure and accelerating its assembly (PubMed:29632366).

Belongs to the GspS/AspS pilotin family.

136 amino acids

MSIKQMPGRVLISLLLSVTGLLSGCASHNENASLLAKKQAQNISQNLPIKSAGYTLVLAQSSGTTVKMTIISEAGTQTTQTPDAFLTSYQRQMCADPTVKLMLTEGINYSITINDTRTGNQYQRKLDRTTCGIVKA

14.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gspS2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here