Attaches a phycocyanobilin (PCB) chromophore to 'Cys-82' of the C-phycocyanain beta subunit (PhcB) and the unique PCB that is attached to allophycocyanin alpha and beta subunits (ApcA and ApcB). In vitro, and probably also in vivo, chromophorylates ApcD and ApcF.

Belongs to the CpcS/CpeS biliprotein lyase family.

198 amino acids

MQSFADAKEFFQYSAGQWQSRRVTHHLPFRRAESGGSNIQVETLEKDDPRIIEICQMHDMDASLSVGGSYVTWAGTMQWDKDDENHEGSTVFALIPDADNPRQGKLLRERGYAEIVPVAGEYHLDHEDGLVLTTEYETMTIYERFWFANPDLRLRTSTVKRFGGFNTTTFCMEERIQTSPVTATAAAETNPLYAISGW

22.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cpcS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here