Protein expression services for cpcC2 | Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2
Description
Rod linker protein, associated with phycocyanin. Linker polypeptides determine the state of aggregation and the location of the disk-shaped phycobiliprotein units within the phycobilisome and modulate their spectroscopic properties in order to mediate a directed and optimal energy transfer.
Family
Belongs to the phycobilisome linker protein family.
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Length
273 amino acids
Sequence
MTSLVSAQRLGIVAVDEAIPLELRSRSTEEEVDAVILAVYRQVLGNDHLMSQERLTSAESLLRGREISVRDFVRAVALSEVYRQKFFHSNPQNRFIELNYKHLLGRAPYDQSEIAFHTDLYHQGGYEAEINSYIDSVEYTENFGDWVVPYFRGFATQRNQKTVGFSRSFQVYRGYATSDRSQGNGSRSRLTRELARNTASPVYAGSTAESLRGTSAGSRNQMYRLQVIQGAAPGRGTRVRRGKAEYLVSYDNLSAKLQQINRQGDTVTMISLA
Mass
30.8 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cpcC2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here