Description
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors.
Family
Belongs to the reaction center PufL/M/PsbA/D family.
Species
Synechococcus sp. (strain JA-3-3Ab)
Sequence
MSVVVRRSAAARRLWSWESFCQWITSTENRLYIGWFGVLMIPTLLAATFCFVIAFIAAPPVDVDGIREPVIGSLLGGNNLISAAVVPTSAAIALHFYPIWEAASLEEWLYNGGPYQLIVFHFLIGVWCYLGRQWELSYRLGMRPWIAVAFSAPAAAATAVLLVYPIGQGSFSEGLPLGIAGTFYFMLAFQAEHNILMHPASWLGVAGVFGGALLASLHGSLVISSLIRETSEEESQNAGYRFGQQEVTYNFLAGHYAFLGRLGIPSLGWRNSRSVHFWMAALPTLGIWAAAIGIGLMAFNLNGFNFNQSILDSQGRFIPTYADLLNRANLGIQAMHAPNAHHFPLLLAAKAD
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service